Scaffold Ga0207504_100167

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0207504_100167

Scaffold Ga0207504_100167

Overview

Basic Information
Taxon OID	3300027455 Open in IMG/M
Scaffold ID	Ga0207504_100167 Open in IMG/M
Source Dataset Name	Soil microbial communities from Kellog Biological Station, Michigan, USA - Nitrogen cycling UWRJ-G06K3-12 (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1482
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)

Source Dataset Sampling Location
Location Name	USA: Michigan
Coordinates	Lat. (^o)	42.4	Long. (^o)	-85.37	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F028554	Metagenome / Metatranscriptome	191	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0207504_1001672	F028554	N/A	MRKAKQVRNRALSAGEGRRAIIVMAALTGLFFLAAFVTAGSLLSTDPRPMSSLSKVTQLPPTEGGEAASRVASIVMETDKKGRCEERQFDNRTGKMVSANYVNCDARLEPERDSTPSENINRERIRAILGAFKK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.