NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0207506_1008006

Scaffold Ga0207506_1008006


Overview

Basic Information
Taxon OID3300027460 Open in IMG/M
Scaffold IDGa0207506_1008006 Open in IMG/M
Source Dataset NameSoil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-ROWE17-C (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)798
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil → Soil Microbial Communities From Arlington Agricultural Research Station In Wisconsin And Kellogg Biological Station In Michigan, Replicating The Bioenergy Cropping Systems Trials (Bcsts)

Source Dataset Sampling Location
Location NameWisconsin, United States
CoordinatesLat. (o)43.42Long. (o)-89.32Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000092Metagenome / Metatranscriptome2385Y
F004042Metagenome / Metatranscriptome456Y
F015246Metagenome / Metatranscriptome256Y

Sequences

Protein IDFamilyRBSSequence
Ga0207506_10080061F015246N/AYEAKDGAREWFIGPELTWLHSQDDRIAGVIQNGSGGDVLLTGITTYVGVRPGMHVWFGMDWDAVHSTGASFMPVRRHISFGITQQFRLHFFK
Ga0207506_10080062F004042AGGAGGMTPKRIVLLLLLGCVLAPVSQAQIKHIEMRVEGMT
Ga0207506_10080063F000092GAGVKQSLGRQSGVQSVEVSLLNGTAEVTPKEDGQIDPAQLLKVTYDSGVTVAGMDMTAQGKIVKDASGNLALQVEPNRSFELVPNELSNGFQNLAGTQRTVTVRGQLYKKPAGKKKNVDTSMPLKLLI

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.