NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0255093_1017417

Scaffold Ga0255093_1017417


Overview

Basic Information
Taxon OID3300027492 Open in IMG/M
Scaffold IDGa0255093_1017417 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8d
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1606
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Moraxellales → Moraxellaceae → Acinetobacter → Acinetobacter baylyi(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater → Freshwater Microbial Communities Amended With Dissolved Organic Matter (Dom) From Various Rivers In The United States

Source Dataset Sampling Location
Location NameUSA: Oregon
CoordinatesLat. (o)46.1812Long. (o)-123.1834Alt. (m)Depth (m)5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005585Metagenome / Metatranscriptome395Y
F013317Metagenome / Metatranscriptome272Y
F056187Metagenome / Metatranscriptome138N

Sequences

Protein IDFamilyRBSSequence
Ga0255093_10174172F013317N/ALIEKKKWDYLADIRARTGAKTLYINATPQGIYQFDLGALIEPDWVLKSLPVTTDFSNKAHSERLCGFLDIRLAELLLV
Ga0255093_10174174F005585AGGGGGMATRGTIFYAFSKSVRHSVFSSETHLTWRLLLSRPNSQECWKVQSARIRISISLDMPLSWVDADFLHQKIGTTLSLTRNHNSNQYCDYCKYRWGQQKGEWHLKARTPAVWKVQSETPTRKAQVRFYCQPCADEAQNWPDGTFYSLKEQLDDAISDFAGREKLDVELPR
Ga0255093_10174175F056187GAGMSNYLDDYVSVQDRLKEFINAYPDYRIKTHTLAESLVANCDVYIVKVELYRTEADNHPWTTGLS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.