Basic Information | |
---|---|
Taxon OID | 3300027509 Open in IMG/M |
Scaffold ID | Ga0209187_1008380 Open in IMG/M |
Source Dataset Name | Marine algal microbial communities from Bantry Bay, Ireland - BantryBay_4 metaG (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 6293 |
Total Scaffold Genes | 14 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 11 (78.57%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Algae → Red Algae → Unclassified → Unclassified → Marine → Genome And Metagenome Analysis Of Marine Red Algae Porphyra |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Bantry Bay, Ireland | |||||||
Coordinates | Lat. (o) | 51.64 | Long. (o) | -9.71 | Alt. (m) | Depth (m) | 2 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F066406 | Metagenome | 126 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0209187_10083801 | F066406 | GAGG | VSVSSRPLTRASKLPVTQLVFVARGVSPRSTPCVCALRGFLPGRVFPDRTTRRHGLAHPPHNWVGRAEPVVTFGEAAGKEGNSTFLSVVAVRQPASGGT |
⦗Top⦘ |