NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209187_1010659

Scaffold Ga0209187_1010659


Overview

Basic Information
Taxon OID3300027509 Open in IMG/M
Scaffold IDGa0209187_1010659 Open in IMG/M
Source Dataset NameMarine algal microbial communities from Bantry Bay, Ireland - BantryBay_4 metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5192
Total Scaffold Genes7 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (71.43%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Rhodophyta → Bangiophyceae → Bangiales → Bangiaceae → Porphyra → Porphyra umbilicalis(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Algae → Red Algae → Unclassified → Unclassified → Marine → Genome And Metagenome Analysis Of Marine Red Algae Porphyra

Source Dataset Sampling Location
Location NameBantry Bay, Ireland
CoordinatesLat. (o)51.64Long. (o)-9.71Alt. (m)Depth (m)2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F039926Metagenome162Y

Sequences

Protein IDFamilyRBSSequence
Ga0209187_10106597F039926N/AMVPHMVHLQDVVKLHIFVLGDLGALLLACFGFDLRFALVAFDLVSDSIWCEGVGVGVGARAGSTWASGDYLRGALGWERRANLRTTNKARSHTHTQAQATQPL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.