 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300027509 Open in IMG/M |
| Scaffold ID | Ga0209187_1023455 Open in IMG/M |
| Source Dataset Name | Marine algal microbial communities from Bantry Bay, Ireland - BantryBay_4 metaG (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2673 |
| Total Scaffold Genes | 5 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 5 (100.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Algae → Red Algae → Unclassified → Unclassified → Marine → Genome And Metagenome Analysis Of Marine Red Algae Porphyra |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Bantry Bay, Ireland | |||||||
| Coordinates | Lat. (o) | 51.64 | Long. (o) | -9.71 | Alt. (m) | Depth (m) | 2 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F019271 | Metagenome | 230 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209187_10234552 | F019271 | GGA | VPHPLLYDLDQRKPPPATTDDSMIDKLLGLHQSGDTYSAKVRWFDYGSKDDIWEPLETIPRNMVVRFLGQKKQHVPGYDWKTPTRQSRRQAGLTAVASIFMDHTWMPAIPRMHVTGDGATNANVSQTDLSTAAAIKEGIPVAWLKSILPSMTHNFTYDLQFALWHFLRHSHEYGQYKTVWRSSAQATLFGNDRSVPELPKGFLVPSVQHLDSILRRLVTTTEEATVVIPQRTNTSWYAWY |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |