Basic Information | |
---|---|
Taxon OID | 3300027509 Open in IMG/M |
Scaffold ID | Ga0209187_1120560 Open in IMG/M |
Source Dataset Name | Marine algal microbial communities from Bantry Bay, Ireland - BantryBay_4 metaG (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 614 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Rhodophyta → Bangiophyceae → Bangiales → Bangiaceae → Porphyra → Porphyra umbilicalis | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Algae → Red Algae → Unclassified → Unclassified → Marine → Genome And Metagenome Analysis Of Marine Red Algae Porphyra |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Bantry Bay, Ireland | |||||||
Coordinates | Lat. (o) | 51.64 | Long. (o) | -9.71 | Alt. (m) | Depth (m) | 2 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F048070 | Metagenome | 148 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0209187_11205602 | F048070 | AGG | MAHVVGFVSLSSADKSTSYSKHARMAVAYQLVLVHCGITTVASSVVVTKRRRTESKCCTGGTRNPLGSTGTGGSLPISVACADVGHT |
⦗Top⦘ |