NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209537_1056206

Scaffold Ga0209537_1056206


Overview

Basic Information
Taxon OID3300027510 Open in IMG/M
Scaffold IDGa0209537_1056206 Open in IMG/M
Source Dataset NameBiogas fermentation microbial communities from Germany - Plant 4 DNA1 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1164
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Biotransformation → Mixed Alcohol Bioreactor → Unclassified → Unclassified → Biogas Fermentantion → Biogas Fermentation Microbial Communities From Biogas Plants In Germany

Source Dataset Sampling Location
Location NameBielefeld, North Rhine-Westphalia, Germany
CoordinatesLat. (o)52.0385Long. (o)8.4956Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F029085Metagenome / Metatranscriptome189N
F047639Metagenome / Metatranscriptome149Y
F075995Metagenome / Metatranscriptome118Y

Sequences

Protein IDFamilyRBSSequence
Ga0209537_10562062F047639AGGAGMRFLNKHKYLRVIKFNSDKSSTITYHLSSKFKPDFLINPDHIFIYNGYRTVIITDKSAETINPLDFNSKFNSSDFKTAIESKLIKDTFNTLKHNKFDTTTILLLLNLVITFGVFYFLLKSQGVI
Ga0209537_10562063F029085AGGMKDIKNDKLKIDELLEENISEQLESGSSDLVSLIAISELTNLEKLKVITRLKDEQVPLLAKLYMYAETFNVPFMKNLADNILQLQISIRGLGRKELVNIVRESTPTETKRSLFGPKDVFR
Ga0209537_10562064F075995AGGAGGMSKYRPLRKANVYITKNFKRVFYGRRTLYVKDHTGRVYIKYKNRYYQAHFDGYHTY
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.