NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209524_1001347

Scaffold Ga0209524_1001347


Overview

Basic Information
Taxon OID3300027521 Open in IMG/M
Scaffold IDGa0209524_1001347 Open in IMG/M
Source Dataset NameForest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M1 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4102
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (83.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa

Source Dataset Sampling Location
Location NameAlgoma, Ontario, Canada
CoordinatesLat. (o)46.42Long. (o)-83.37Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F005268Metagenome / Metatranscriptome406Y
F025325Metagenome / Metatranscriptome202Y
F072127Metagenome / Metatranscriptome121Y

Sequences

Protein IDFamilyRBSSequence
Ga0209524_10013473F025325AGGAGGMLSDRPKRLEKTWEELTAAASMETDPEKLGTILEEILAALEERQRTQSLLQNPFVGNRQL
Ga0209524_10013474F005268GAGGVSRSDEETEEQQVWRALSEAGLVEIRLEEFAERIKDVKRIVTVRLRELLDFNTGIKERESAAYSLGTLRGLELKVLANPPKPPDSSEM
Ga0209524_10013475F072127GAGGLVWRDFILEDGRVIPEHRISDCPQPQVWRKISEVTDNEREECEERLLSMAGAGMDPRKRDQPFWAELNQYLAYTYLRYKQAA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.