NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209734_1000096

Scaffold Ga0209734_1000096


Overview

Basic Information
Taxon OID3300027535 Open in IMG/M
Scaffold IDGa0209734_1000096 Open in IMG/M
Source Dataset NameForest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M2 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)9695
Total Scaffold Genes14 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (78.57%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa

Source Dataset Sampling Location
Location NameThunder Bay, Ontario, Canada
CoordinatesLat. (o)49.08Long. (o)-89.38Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002450Metagenome / Metatranscriptome558Y
F016337Metagenome / Metatranscriptome248Y
F071458Metagenome122Y

Sequences

Protein IDFamilyRBSSequence
Ga0209734_100009610F016337GGAMLFSSGPQQERPRELKGGGHLLGETAEHFFSESAVGQLLRTCEAGDWKAVKQLAKAVDPASKPNAKDICAKAALVKQQATSGARQEYRDGDETTMRTDTFTLDGGYLVKIDMVFNAPTTDVAGYHPKYFGELFEGLREAYGAPSKSYTEPVFDVYGAKYDAHRAEWMGKQDVITIIEQPGRDGRTEIVVETLAERNRATKTVNPLQ
Ga0209734_10000964F002450AGGAMTETSTAEHTDRRATSRIDAHLPLFIYGSLLGGDPFYEETFTISINGTGGLILMTSSVQPGQRIMVTNQGNDQTQECVVVSVAAQPAGSHVAFKFPSPMPQFWHGLEIGKGTLRSWVEYFIEGLILQIRGDRTPERPVPDKFDKRGNQEKKLLHRPELFLLPSPRE
Ga0209734_10000969F071458N/AMWPFRNKTKQPKVVFNREHIGRELTPIPKRPLSQEEMEWVRQSLSSRKEFVEFRPPQLFAVSKCPCGTCRTVGLEPVELPNWSAESGHLGGITIETKDHGPIDILLHAAKGFLVEMEVIWYYFPKPFPKSWVEVSRTVDPLH
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.