Scaffold Ga0208984_1102817

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0208984_1102817

Scaffold Ga0208984_1102817

Overview

Basic Information
Taxon OID	3300027546 Open in IMG/M
Scaffold ID	Ga0208984_1102817 Open in IMG/M
Source Dataset Name	Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M3 (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	618
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa

Source Dataset Sampling Location
Location Name	El Dorado National Forest, Georgetown, California, USA
Coordinates	Lat. (^o)	38.88	Long. (^o)	-120.64	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F064240	Metagenome	129	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208984_11028171	F064240	N/A	ALWLLSVPQYLPEYLFKVAPVLAAGTGLFENHSPGGTVARLFDPNTFLGAARDTPTAARAITTAIALLALGITFWVLRRPQTDRQDRALEAAAVVAVGPLVASYSWGTHLVLLLLPIVILVAWSISRRDWAVLGLVAAGWLLIGPGHKWFQTLLVSGYPNMLVLRLMAEFGVAGITCIWVASLLAIRRQRTDLMRPTRIVPRNKN

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.