 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300027554 Open in IMG/M |
| Scaffold ID | Ga0209831_1039842 Open in IMG/M |
| Source Dataset Name | Marine algal microbial communities from Maine, USA - Maine_Asex4_metaG (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 2009 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Spiralia → Lophotrochozoa → Mollusca → Bivalvia → Autobranchia → Heteroconchia → Euheterodonta → Imparidentia → Neoheterodontei → Venerida → Veneroidea → Veneridae → Mercenaria → Mercenaria mercenaria | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Algae → Red Algae → Unclassified → Unclassified → Marine → Genome And Metagenome Analysis Of Marine Red Algae Porphyra |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Maine, USA | |||||||
| Coordinates | Lat. (o) | 44.342 | Long. (o) | -68.065 | Alt. (m) | Depth (m) | 2 | Location on Map |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F060562 | Metagenome | 132 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209831_10398422 | F060562 | N/A | MRSFRPVLDTGAGVNIGRTSVLPSKWMAYAEELTTLPRIRVANNNRLVTKYAIHLYVDTGGVRLFDRFLVADNLSVPCILYTEFIEQNIEGILPRLRKIVWQEHVRCTEEQPWPTPILACLDDSAWDRHWQDKPARVRACKQVRVNGHKEEWIMATCDTPGMVTITPNIRLCRHQSMAVARGIAIVKPDEPFLVKLCNFGKDQVVVRKNSTLGFAEPYQGPMLSAVLDDNTPKGDTDKSSDDASRDPLEDLDLSEAPEYLHKQIRDMLETHSSMWN |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |