Basic Information | |
---|---|
Taxon OID | 3300027555 Open in IMG/M |
Scaffold ID | Ga0207752_1009650 Open in IMG/M |
Source Dataset Name | Marine sediment microbial community from Union City, CA, USA - Pond 2C Sediment 2 (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2702 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 2 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Enviromental → Environmental Microbial Communities From Fremont, Ca And La Paraguera, Puerto Rico |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Eden Landing Ponds, San Francisco, CA, USA | |||||||
Coordinates | Lat. (o) | 37.569017 | Long. (o) | -122.102433 | Alt. (m) | Depth (m) | .11 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F048391 | Metagenome / Metatranscriptome | 148 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0207752_10096502 | F048391 | GAGG | MEFKGDPMDDRISVEPINTLDYLNELLGKGYVIKGPRKDSSRDLISFKAFLKKGKEFAPEGWLLHMGYEFIEPNTFTKGHKIAYKIIDEIPDERFNSNYTLVKENREIPLYLKVAVLKAE |
⦗Top⦘ |