NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209222_1000434

Scaffold Ga0209222_1000434


Overview

Basic Information
Taxon OID3300027559 Open in IMG/M
Scaffold IDGa0209222_1000434 Open in IMG/M
Source Dataset NameForest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O3 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)9287
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (58.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa

Source Dataset Sampling Location
Location NameThunder Bay, Ontario, Canada
CoordinatesLat. (o)49.08Long. (o)-89.38Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F066229Metagenome / Metatranscriptome127Y
F102031Metagenome / Metatranscriptome102Y

Sequences

Protein IDFamilyRBSSequence
Ga0209222_10004344F102031GAGMVVALCAAVGCSFSDNRKEAEQLAEKYFSTMQGENIERVLPLYSTRFYAATSRADWLAFLQNQRARCGTPKTHSLVTWNVLNMFGTNAGTTTTLVYDVQYSNCRVSEKMTIFKPSGGKIQIQGHFLTPKAGIQNDNGDSQPTLRT
Ga0209222_10004345F066229N/AMPEPILKISVTCPHCALESLAEMPIALIANALLIGKAIRLYSRCHNHYWTATFAEREQLRKSLAALKIESHTHRVAPHAEQLEAAR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.