Basic Information | |
---|---|
Taxon OID | 3300027576 Open in IMG/M |
Scaffold ID | Ga0209003_1010981 Open in IMG/M |
Source Dataset Name | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M3 (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1362 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Acidobacteria | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Davy Crockett National Forest, Groveton, Texas, USA | |||||||
Coordinates | Lat. (o) | 31.11 | Long. (o) | -95.15 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F005435 | Metagenome / Metatranscriptome | 401 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0209003_10109813 | F005435 | AGAAGG | MSCKSCQSQNQREFNGEIAIQSPGLKGLDKPIVWVFPKLAVCLDCGFVEFAVPENERRLLKEGSPPSKAV |
⦗Top⦘ |