NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209527_1000032

Scaffold Ga0209527_1000032


Overview

Basic Information
Taxon OID3300027583 Open in IMG/M
Scaffold IDGa0209527_1000032 Open in IMG/M
Source Dataset NameForest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)25829
Total Scaffold Genes26 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)19 (73.08%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa

Source Dataset Sampling Location
Location NameAlgoma, Ontario, Canada
CoordinatesLat. (o)46.42Long. (o)-83.37Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000503Metagenome / Metatranscriptome1073Y
F002873Metagenome / Metatranscriptome524Y
F022384Metagenome / Metatranscriptome214Y

Sequences

Protein IDFamilyRBSSequence
Ga0209527_100003217F000503AGGAGMSAEAPGRTSIMPLRDLVRLYRCYAGTFGEPVALSAFGLTNTETERLFSGYDEDYHISRFFHFSEAAGEKFLVNGIPATHVSLDAEIETIL
Ga0209527_100003219F022384N/AMFAALVLDYRLAFLFLAALSLGSAVPLAFGWARVLPEEPLPFGHAEDSFRRAKNSPAAPVLMSKKRDPFAIVLLLCVTVSYACQLPGVPRGMGFGSIPTVIPHNTRGWIEFAAIWFLVLIPGFASVYSLLRPNFLRVPLIAAGMMILLLWLLAAPLRAALEAVS
Ga0209527_100003220F002873N/AMILGIAGLTFVLGANYLLVYTLKQQVTRERERQDRTYWSAFNAVEQFGEHADQVSEQKAKAALDEARQKGLSKIRARILQNYLEDLEHCYQGDRESCTKANTDMNEAIRVPAERK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.