Scaffold Ga0208966_1199536

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0208966_1199536

Scaffold Ga0208966_1199536

Overview

Basic Information
Taxon OID	3300027586 Open in IMG/M
Scaffold ID	Ga0208966_1199536 Open in IMG/M
Source Dataset Name	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	511
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic → Freshwater Lentic Microbial Communities From The Great Laurentian Lakes, Mi, Usa For Biogeochemical Studies

Source Dataset Sampling Location
Location Name	Great Lakes, Michigan, USA
Coordinates	Lat. (^o)	44.701094	Long. (^o)	-82.854085	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F011298	Metagenome / Metatranscriptome	292	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0208966_11995362	F011298	N/A	DMAHFVKLSVLDPGHDDLENTTNRKYNPQLINLDMVINVEQSKVHSLIFTKNNTQHPIRVRESLDEILSVSKGCVKNVLNG

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.