NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209331_1036158

Scaffold Ga0209331_1036158


Overview

Basic Information
Taxon OID3300027603 Open in IMG/M
Scaffold IDGa0209331_1036158 Open in IMG/M
Source Dataset NameForest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M3 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1264
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa

Source Dataset Sampling Location
Location NameAlgoma, Ontario, Canada
CoordinatesLat. (o)46.42Long. (o)-83.37Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008837Metagenome / Metatranscriptome327Y
F011804Metagenome / Metatranscriptome287Y

Sequences

Protein IDFamilyRBSSequence
Ga0209331_10361582F011804GGAGMNHENVDSRRMDLHRRIALVLRKEPGLVRDFAERLRSKLATARSAAVVSDIEWEWYIILTLWSPLQVIRLLEDSSEQAVRLRQNSPFVSLLPVPLAYRLIE
Ga0209331_10361583F008837AGGAMELMEVYHEAMATWIIARVTSGKCEGAAFVFGLIESAIRKEATEILLTPVQELDMVRMDFGRLHCYYRQPDITRAQFAYLAIYLVLIGNVAAEEARTERLFRGSDERLYNLQFGKMRLLDSEPAVVIYIEPVRPANDRQRPQAKK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.