NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208324_1002219

Scaffold Ga0208324_1002219


Overview

Basic Information
Taxon OID3300027604 Open in IMG/M
Scaffold IDGa0208324_1002219 Open in IMG/M
Source Dataset NamePeat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7384
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)12 (92.31%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil → Peatlands Soil Microbial Communities From Germany And Austria, That Are Sulfate Reducing

Source Dataset Sampling Location
Location NameGermany: Weissenstadt
CoordinatesLat. (o)50.1318Long. (o)11.881Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000042Metagenome / Metatranscriptome3762Y
F001851Metagenome / Metatranscriptome626Y
F013120Metagenome / Metatranscriptome274Y

Sequences

Protein IDFamilyRBSSequence
Ga0208324_10022193F013120GGAGGMEYFRFDHPPDRLILCHRSNCEDIADYLEINEQGREDLVCAVHTSSERHASVLPNGVPHAEPHGSRTAA
Ga0208324_10022194F000042AGAAGGMKNTKFVVKVNVGGTRAPQYVQRIDRAPIQTTTNRKLALVMGKFMAEDTIKSLQNSRRIPELISVQVEYGQLSV
Ga0208324_10022195F001851AGGAGMNATSFSFGLLMVLFTILLLHRMRKLNPRIAAYGSQRMCPSCGLITSRLKACCLECGESLTGVSVTPILEK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.