NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208974_1028106

Scaffold Ga0208974_1028106


Overview

Basic Information
Taxon OID3300027608 Open in IMG/M
Scaffold IDGa0208974_1028106 Open in IMG/M
Source Dataset NameFreshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1709
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (75.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic → Freshwater Lentic Microbial Communities From The Great Laurentian Lakes, Mi, Usa For Biogeochemical Studies

Source Dataset Sampling Location
Location NameGreat Lakes, Michigan, USA
CoordinatesLat. (o)44.504638Long. (o)-83.045851Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000808Metagenome / Metatranscriptome882Y
F005348Metagenome / Metatranscriptome403Y
F014849Metagenome / Metatranscriptome259Y
F100416Metagenome / Metatranscriptome102N

Sequences

Protein IDFamilyRBSSequence
Ga0208974_10281061F000808AGGAMEYNYSLTTSYDGELIHTLRVSDMLEAVRAWDKCVDYGFAKEYATYNLSDPTGKMYTKTFYTNGEVVIK
Ga0208974_10281062F100416AGAAGGMGKVKEALMDILEHDLCYGYGWIYQGNGIDFDSEACECNPYSISADELMDWKLN
Ga0208974_10281063F014849N/AVEGVKQMITNLDVIAIIIALLGCLTVMGLFWKQNIAQQKEIRRLRNELRKAFKV
Ga0208974_10281065F005348AGGMISSVMTFKCDECNGAGYIFWGDNLAYDVEKCECENFALGTLFTTKEAD
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.