NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208951_1141933

Scaffold Ga0208951_1141933


Overview

Basic Information
Taxon OID3300027621 Open in IMG/M
Scaffold IDGa0208951_1141933 Open in IMG/M
Source Dataset NameFreshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG MI27MSRF (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)631
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic → Freshwater Lentic Microbial Communities From The Great Laurentian Lakes, Mi, Usa For Biogeochemical Studies

Source Dataset Sampling Location
Location NameGreat Lakes, Michigan, USA
CoordinatesLat. (o)44.504638Long. (o)-83.045851Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F029747Metagenome / Metatranscriptome187Y
F038235Metagenome166N
F039047Metagenome / Metatranscriptome164N

Sequences

Protein IDFamilyRBSSequence
Ga0208951_11419331F038235N/AMIREILAPFERVTYVREDGNQAVYKVFRPTKHLFINKKKDNGAVVGFRAWKMPDSGADERMGWRSFRFDRIA
Ga0208951_11419332F029747AGGMKYKLMIDTDTCTSFSTYPHTREGLDKALDRVDKVRSKDGFKSANIVSDRDGEVFALDMSLAIN
Ga0208951_11419333F039047N/AIDMKMKIEVDINDLVALKVALGNAERRINELMNDKPDWRNIYEFDKNSVEKAQKVLAKMIANS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.