NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208044_1003119

Scaffold Ga0208044_1003119


Overview

Basic Information
Taxon OID3300027625 Open in IMG/M
Scaffold IDGa0208044_1003119 Open in IMG/M
Source Dataset NamePeat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7813
Total Scaffold Genes13 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)9 (69.23%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil → Peatlands Soil Microbial Communities From Germany And Austria, That Are Sulfate Reducing

Source Dataset Sampling Location
Location NameGermany: Weissenstadt
CoordinatesLat. (o)50.1318Long. (o)11.881Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001010Metagenome / Metatranscriptome807Y
F002004Metagenome / Metatranscriptome605Y
F004291Metagenome / Metatranscriptome445Y

Sequences

Protein IDFamilyRBSSequence
Ga0208044_10031192F004291AGGAGGMNRKRVALLVLLGSMVVVPVAQAKIKHIEMRVEGMT
Ga0208044_10031197F001010AGGLYYTEDMAVTIEMQNTGDSRARREILAGVEHVMSDVAGEWLVSIVGSRANDNWEMKVEGPQGFERSYTLVGDAGEHQPDVIRNVLIKVLPASTR
Ga0208044_10031198F002004GAGMKKIPNSSRRLREHILRALNQIRKPSTADEITELLNRDLDLEDRPFQAKDVAEWLRNTKDTALTLYWSGTRPRK

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.