Scaffold Ga0209149_1282304

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0209149_1282304

Scaffold Ga0209149_1282304

Overview

Basic Information
Taxon OID	3300027626 Open in IMG/M
Scaffold ID	Ga0209149_1282304 Open in IMG/M
Source Dataset Name	Marine gutless worms symbiont microbial communities from Max Planck institute for Marine Microbiology, Germany - Olavius algarvensis Type A CAVOLI.2 (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	828
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Cytophagia → Cytophagales → Cytophagaceae → Candidatus Nephrothrix → unclassified Candidatus Nephrothrix → Candidatus Nephrothrix sp. EaCA	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Annelida → Digestive System → Digestive Tube → Extracellular Symbionts → Marine Gutless Worms Symbiont → Marine Gutless Worms Symbiont Microbial Communities From Various Locations

Source Dataset Sampling Location
Location Name	Max Planck institute for Marine Microbiology, Germany
Coordinates	Lat. (^o)	51.321602	Long. (^o)	12.394572	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F012932	Metagenome	276	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209149_12823041	F012932	N/A	LNNSTSKRVLDLLEPVKLMVWKVVIERVTVIKFRMDNGGGNDAGCFEVEIWADTAKFTNVIVAGFKKCRDLAREGKVFIKDKAKVASRVGCSERRVVNFTKLLFKSDKKKLSFRRVESKKVCSYPGRDLL

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.