Basic Information | |
---|---|
Taxon OID | 3300027632 Open in IMG/M |
Scaffold ID | Ga0209339_1094615 Open in IMG/M |
Source Dataset Name | Olavius algarvensis symbiont microbial communities from Tuscany, Italy - Type A ELBA extract 3 (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2128 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Deuterostomia → Chordata → Craniata → Vertebrata → Gnathostomata → Teleostomi → Euteleostomi → Sarcopterygii → Dipnotetrapodomorpha → Tetrapoda → Amniota → Sauropsida → Sauria → Archelosauria → Testudinata → Testudines → Cryptodira → Durocryptodira → Testudinoidea → Emydidae → Trachemys → Trachemys scripta → Trachemys scripta elegans | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Annelida → Digestive System → Unclassified → Unclassified → Marine Gutless Worms Symbiont → Marine Gutless Worms Symbiont Microbial Communities From Various Locations |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Zanca-sant'andrea, Tuscany, Italy | |||||||
Coordinates | Lat. (o) | 42.8072 | Long. (o) | 10.1411 | Alt. (m) | Depth (m) | 6 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F024221 | Metagenome | 207 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0209339_10946152 | F024221 | N/A | MVGTVFDDFRAFQTAFKAFQDESNQLFVVKKSKSVDAVNKKLYNSVILLYLTILNNFLLRRHTHHTVEYAIAMKSN |
⦗Top⦘ |