Scaffold Ga0209905_1017917

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0209905_1017917

Scaffold Ga0209905_1017917

Overview

Basic Information
Taxon OID	3300027634 Open in IMG/M
Scaffold ID	Ga0209905_1017917 Open in IMG/M
Source Dataset Name	Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812S1M
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	981
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (33.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost → Thawing Permafrost Microbial Communities From The Arctic, Studying Carbon Transformations

Source Dataset Sampling Location
Location Name	Sweden: Kiruna
Coordinates	Lat. (^o)	68.3532	Long. (^o)	19.0475	Alt. (m)		Depth (m)	0
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F087283	Metagenome / Metatranscriptome	110	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209905_10179173	F087283	N/A	ALHAGQPYNAGYLKKYLDDTRQLLPRGVSWGTTIHETPDAKDKTVDVEIRFKQQ

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.