NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208612_1004704

Scaffold Ga0208612_1004704


Overview

Basic Information
Taxon OID3300027638 Open in IMG/M
Scaffold IDGa0208612_1004704 Open in IMG/M
Source Dataset NamePolar desert microbial communities from Antarctic Dry Valleys - UQ889 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)5237
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (58.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert → Polar Desert Microbial Communities From Antarctic Dry Valleys

Source Dataset Sampling Location
Location NameAntarctic Dry Valleys
CoordinatesLat. (o)-78.1358Long. (o)164.1187Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F003229Metagenome / Metatranscriptome499Y
F006197Metagenome379Y

Sequences

Protein IDFamilyRBSSequence
Ga0208612_100470410F006197GGAGMRLFVALEKPMRLVGGTGPSREVRLPPGYSLDLSDPDVLVLRCPHGTAAAHFSARGAAAEAIEQEARMHYRARNRSA
Ga0208612_100470411F003229AGGAGVQQHPQPATIAILGANTVVGRALCALLESSGYQTTPLGVYPTGVVDELLDGADLLLLAPRLDEGVREAFVGAMGKSTPRKGEMPVIALSTVIEKDLPEKEGVISVPWPCETKVLVERIEAALLVPAASTTSTTQARTG
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.