Scaffold Ga0209347_1003861

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0209347_1003861

Scaffold Ga0209347_1003861

Overview

Basic Information
Taxon OID	3300027640 Open in IMG/M
Scaffold ID	Ga0209347_1003861 Open in IMG/M
Source Dataset Name	Deep subsurface microbial communities from Mt. Terri, Switzerland - Autotrophic microbial communities BRH/23 (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	16655
Total Scaffold Genes	15 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	8 (53.33%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Deep Subsurface → Clay → Unclassified → Deep Subsurface → Deep Subsurface Microbial Communities From Mt. Terri Underground Rock Laboratory, Switzerland, That Are Autotrophic

Source Dataset Sampling Location
Location Name	Mt. Terri, Switzerland
Coordinates	Lat. (^o)	47.379	Long. (^o)	7.1648	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F020065	Metagenome	226	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209347_10038618	F020065	AGGA	VAIFAVMKKSQIQQIKEGRAMHEKTWSGRLQPFGPKVQLNGPNAVNLTTVPSSAKEKYNGGIDPKPETTGAK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.