NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209799_1001997

Scaffold Ga0209799_1001997


Overview

Basic Information
Taxon OID3300027654 Open in IMG/M
Scaffold IDGa0209799_1001997 Open in IMG/M
Source Dataset NameTropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 MoBio (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4026
Total Scaffold Genes10 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)6 (60.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil → Tropical Forest Soil Microbial Communities From Panama Analyzed To Predict Greenhouse Gas Emissions

Source Dataset Sampling Location
Location NamePanama: Oeste
CoordinatesLat. (o)9.1086Long. (o)-79.8436Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001555Metagenome / Metatranscriptome672Y
F085448Metagenome111N

Sequences

Protein IDFamilyRBSSequence
Ga0209799_10019974F001555GAGMKSPIRQCALLLMAFTVWAKPALARSYLNCSTKKVVIVDAPTGNSSLSTEENVGFWIDDAAKIMTLADGTPLVVRRFDDRWISAARGDVSYELDRQDGNLTYASSTTKDGTATIIIGSGRCKLAAGPAG
Ga0209799_10019979F085448GAGMMGQAAIYNAVNRPGLYSSKARQGPHPGPAVIRAGNHLAVACLFFGAAFAAFVAGSLEQRIGNLFSVGVIPAVGFYAGGHILGQLLVFGVQLCDMIMARCFRYVVRLLNNLLSWPGTHVSNWLTGRPHQTKRAELTPDALFAADSRNSHFSPPMT

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.