NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208975_1017697

Scaffold Ga0208975_1017697


Overview

Basic Information
Taxon OID3300027659 Open in IMG/M
Scaffold IDGa0208975_1017697 Open in IMG/M
Source Dataset NameFreshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2369
Total Scaffold Genes8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (87.50%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic → Freshwater Lentic Microbial Communities From The Great Laurentian Lakes, Mi, Usa For Biogeochemical Studies

Source Dataset Sampling Location
Location NameGreat Lakes, Michigan, USA
CoordinatesLat. (o)44.701094Long. (o)-82.854085Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002826Metagenome / Metatranscriptome527Y
F022371Metagenome / Metatranscriptome214Y
F043281Metagenome / Metatranscriptome156N

Sequences

Protein IDFamilyRBSSequence
Ga0208975_10176971F043281N/AVVPNHFGMQTWANIQAHFWDIPLSGMDPAYNCMTSVEQHYGLDRHKDAMIIHYAGQSGDMAKLAEQIKADDAKLAELGR
Ga0208975_10176973F022371AGGAMFCLLDIGAIVWVISSFILYSSLLLSAIYCALYIIFKLIEVIRKELDL
Ga0208975_10176977F002826AGGAGMNVEARDRLKWARDCLLNARNRLAVERDRASHGHAIDMIQIITMVDAASLVCKEVAGDE

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.