NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209736_1000017

Scaffold Ga0209736_1000017


Overview

Basic Information
Taxon OID3300027660 Open in IMG/M
Scaffold IDGa0209736_1000017 Open in IMG/M
Source Dataset NameForest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M3 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)71605
Total Scaffold Genes54 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)39 (72.22%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa

Source Dataset Sampling Location
Location NameThunder Bay, Ontario, Canada
CoordinatesLat. (o)49.08Long. (o)-89.38Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F029230Metagenome / Metatranscriptome189Y
F045227Metagenome / Metatranscriptome153Y
F056033Metagenome / Metatranscriptome138Y

Sequences

Protein IDFamilyRBSSequence
Ga0209736_100001716F029230N/AMKTFQIAGLLAFVIGMAFLCCYAPWTSTPAGSSAAHDSLGYGAIWSQQFATVGGARVDWGAFAMLAGVVAFFAIVIGAAAYFFRGRRGAEREDV
Ga0209736_100001719F056033AGGAGGMYAWKCWRESRARFIFLLIMFGASALLFTLMHGLTEQDGWWHFDRTEYTRDPATMVHLVSGMVLSVLSFSGFLSAVFLGATASGSEIEPGTIEYLWTRPRTRTSLTWTHWGICVAEMVLVAVVPTYLAAAILGTLTRNWNLPVLFVAPWIMVIFGLPLLGLTTLMTALKRSASGGLIYTSAVVGVYLIVRQIITVPTHLNLPTLFAGPLVWLVTNNQPLAVAFPWGSLARAVFLAAALPLAAQYLLKRAEV
Ga0209736_100001747F045227N/AMASMSTIYRAASFLAILCCYGAVHSASAQTGGLDFIARVTPTAARPEPVRQFTFYILTKSYVQIAKEVEAQDELPSREEFIGGLKLSPELKTWLKAHEIMDLTMPGLDKAVTPDEVLKVPEFLLAYQRSNSGGVTNGIPKPKYTDADKADHPDKYEKQHQEYLVALKKFIAAHPETESGMELELDAVNPQRKWAKLESDHKKRVQRMAPEVAQMKYLVAKADTDLEGRGAVGGLAAGSYWISSLNLDANAGDMRVRWDVPITVHAGQTARVELTNLNAADARATTTP

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.