Scaffold Ga0207873_1071423

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0207873_1071423

Scaffold Ga0207873_1071423

Overview

Basic Information
Taxon OID	3300027664 Open in IMG/M
Scaffold ID	Ga0207873_1071423 Open in IMG/M
Source Dataset Name	Cellulose adapted compost microbial communities from Newby Island Compost Facility, Milpitas, CA, USA - BGW Initial Compost (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1186
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Solid Waste → Feedstock → Composting → Unclassified → Feedstock Adapted Compost → Comparative Metagneomics Of Mesophilic And Thermophilic Cellulose-Adapted Consortia

Source Dataset Sampling Location
Location Name	Berkeley, CA
Coordinates	Lat. (^o)	37.86971	Long. (^o)	-122.31414	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F012882	Metagenome / Metatranscriptome	276	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0207873_10714231	F012882	N/A	ETSYFKAPDAVWVKLVIPTAPKGVGRDEFGPLDSQTSIVVRR

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.