 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300027664 Open in IMG/M |
| Scaffold ID | Ga0207873_1098290 Open in IMG/M |
| Source Dataset Name | Cellulose adapted compost microbial communities from Newby Island Compost Facility, Milpitas, CA, USA - BGW Initial Compost (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 939 |
| Total Scaffold Genes | 3 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (33.33%) |
| Novel Protein Genes | 1 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
| Associated Families | 1 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
| Source Dataset Ecosystem |
|---|
| Engineered → Solid Waste → Feedstock → Composting → Unclassified → Feedstock Adapted Compost → Comparative Metagneomics Of Mesophilic And Thermophilic Cellulose-Adapted Consortia |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | Berkeley, CA | |||||||
| Coordinates | Lat. (o) | 37.86971 | Long. (o) | -122.31414 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F088555 | Metagenome | 109 | N |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0207873_10982902 | F088555 | GGAGG | MAIRMYFDETVSSLVRDDISPTLGSPDTYEGPAEGGSVERKLYLYSDNFQRTYSNVQISALNADADVQIHYALDQNGQPGTYQTNLQLPDGDYQTPVPVWVKVTFAPTTEPTLRTDLRHHLQWLEAIAG |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |