Basic Information | |
---|---|
Taxon OID | 3300027666 Open in IMG/M |
Scaffold ID | Ga0209282_1360114 Open in IMG/M |
Source Dataset Name | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 591 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Root Nodules → Root Nodule Microbial Communities Of Legume Samples Collected From Usa, Mexico And Botswana |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: California | |||||||
Coordinates | Lat. (o) | 34.0722 | Long. (o) | -118.4441 | Alt. (m) | Depth (m) | 0 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F001430 | Metagenome | 696 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0209282_13601141 | F001430 | N/A | IDKYAENNVLPITFEIVTDECAENKVLPITFEIVTDAYAVNKNLADYI |
⦗Top⦘ |