 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Taxon OID | 3300027670 Open in IMG/M |
| Scaffold ID | Ga0209423_10058107 Open in IMG/M |
| Source Dataset Name | Nasutitermes corniger crop gut microbial community from laboratory colony in Florida, USA - Nc150C (SPAdes) |
| Source Dataset Category | Metagenome |
| Source Dataset Use Policy | Open |
| Sequencing Center | DOE Joint Genome Institute (JGI) |
| Sequencing Status | Permanent Draft |
| Scaffold Components | |
|---|---|
| Scaffold Length (bps) | 1514 |
| Total Scaffold Genes | 2 (view) |
| Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Novel Protein Genes | 2 (view) |
| Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
| Associated Families | 2 |
| Taxonomy | |
|---|---|
| All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Polyneoptera → Dictyoptera → Blattodea → Blattoidea → Termitoidae → Termopsidae → Termopsinae → Termopsini → Zootermopsis → Zootermopsis nevadensis | (Source: UniRef50) |
| Source Dataset Ecosystem |
|---|
| Host-Associated → Arthropoda → Digestive System → Gut → Unclassified → Termite Gut → Cubitermes And Nasutitermes Termite Gut Microbial Communities From Max Planck Institute For Terrestrial Microbiology, Germany |
| Source Dataset Sampling Location | ||||||||
|---|---|---|---|---|---|---|---|---|
| Location Name | laboratory colony in Florida, USA | |||||||
| Coordinates | Lat. (o) | 26.0625 | Long. (o) | -80.2332 | Alt. (m) | Depth (m) | Location on Map | |
| Zoom: | Powered by OpenStreetMap © | |||||||
| Family | Category | Number of Sequences | 3D Structure? |
|---|---|---|---|
| F063059 | Metagenome | 130 | Y |
| F095690 | Metagenome | 105 | Y |
| Protein ID | Family | RBS | Sequence |
|---|---|---|---|
| Ga0209423_100581071 | F095690 | AGGA | MCFLQNAKFEVILLVILLFSAITNGELLPSASLTLQEIHLVRCLTYISHRYFASGRSLVISSPSTYQDVQLQIIAEIQQNSIWPVVVTVDGNIRKPITKDFVDKDGSYIILIPDGNITSLITEIIGLALDKTKFTRLWNSEARFVVVGANEFSMLQQTEIFNFLSKLRIYNCIIVSQDYNVIDKEYSRPTNVIALDTEMKLEVYTWFPYQSSDRCTAVNDITLLDSLVISAQGHFTKNTDLFPQKISKYLNGCPMKAVVRNANRDFTTKYVHYNDSNGNVRTHVKSLEYDLLKIVYEQMNMTFVHVPTSEGFEFQESLANNLVFAMLAKEAIIALGAVGTTYKIDPLFDYTDT |
| Ga0209423_100581072 | F063059 | N/A | REKHTQARNSERNDGVRGIVDTDTPRITAHMLVNELVSVLYPCHSDVQLYRPTSVVEMAAISIDMIRTNHSSTESILKMLLHLGYLTEHGTYQRTLMMY |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |