NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209383_1001398

Scaffold Ga0209383_1001398


Overview

Basic Information
Taxon OID3300027672 Open in IMG/M
Scaffold IDGa0209383_1001398 Open in IMG/M
Source Dataset NameMarine microbial communities from the West Antarctic Peninsula - Coastal water metaG029-DNA (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)15092
Total Scaffold Genes28 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)26 (92.86%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From The West Antarctic Peninsula, For Metatranscriptomic Analysis

Source Dataset Sampling Location
Location NameAtlantic Ocean: West Antarctic Peninsula
CoordinatesLat. (o)-64.8156Long. (o)-64.0406Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F030875Metagenome / Metatranscriptome184N
F056081Metagenome / Metatranscriptome138Y
F071666Metagenome / Metatranscriptome122N

Sequences

Protein IDFamilyRBSSequence
Ga0209383_100139819F056081GGAGMWAINWTEAGCTEYANSLEDAHKIGQRGGPFYIITFLGDK
Ga0209383_100139821F030875N/AMKTTKTLKIKVITNRPAPKRITQPASNWRDIMGAMKRGHWFEVECNTGDNVYSRVNAAANSYCKGRYTFYKAAKGQYIFEIIKG
Ga0209383_100139822F071666AGGAMFDLYCPHCGEPWEHDMLHDVIDMKYMEAAEAFKVQGCTVFQILRQRIQGKGSNCKAKPVVSADELAGINAAHNESDYPEEWDYDMARVIFTTNFKINDIL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.