NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209118_1027128

Scaffold Ga0209118_1027128


Overview

Basic Information
Taxon OID3300027674 Open in IMG/M
Scaffold IDGa0209118_1027128 Open in IMG/M
Source Dataset NameForest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_M1 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1777
Total Scaffold Genes4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa

Source Dataset Sampling Location
Location NameThunder Bay, Ontario, Canada
CoordinatesLat. (o)49.08Long. (o)-89.38Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F016943Metagenome / Metatranscriptome243Y
F099009Metagenome / Metatranscriptome103Y

Sequences

Protein IDFamilyRBSSequence
Ga0209118_10271281F099009N/ANSPNKQPGRTDNTNPSAPKQQNRADEIGKNLRVLALQFPVLSASMGERRMP
Ga0209118_10271284F016943AGGMANLRRRGSSLFPGLLLLFVGMLLLLHNYRGLGIVNVLGHWWPLILIFWGGIKLYERMAASRSGDPGAASITSGEVFLVLGLLSLLGIVVAVDYGKENLPGHIREWGNSFDFDLEVAPKSVPADARITIRNGRGNISVRPSDDAQIRISGKKKANAWNENDAQQVAERVGVEVVQNGDGYEIHPTGVSKGESRISLDLDVTVPKKASLTVRN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.