NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0208991_1059675

Scaffold Ga0208991_1059675


Overview

Basic Information
Taxon OID3300027681 Open in IMG/M
Scaffold IDGa0208991_1059675 Open in IMG/M
Source Dataset NameForest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM3_M2 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1151
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Multiple Locations In Canada And Usa

Source Dataset Sampling Location
Location NameEl Dorado National Forest, Georgetown, California, USA
CoordinatesLat. (o)38.88Long. (o)-120.64Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008529Metagenome / Metatranscriptome332Y
F012273Metagenome / Metatranscriptome282Y

Sequences

Protein IDFamilyRBSSequence
Ga0208991_10596751F008529N/AIVSSISSAESNNFAKFDGQRVAALKSALSGTILSNSGLLVLAACLFGLIRRLGRLLGEEAAQSRQELALRDLQLEKLTSALSGQARSNMIAINTNSRLLLDNYGGFLPRQGHEYAEQMTEAAAQMEQLRLDLVGSRGSNGDGKAA
Ga0208991_10596752F012273AGGAGMRLSKLALVQCAAVILLAASASATGNDPCKVLTAEQFSRIMGYAATIDKTASNQMSCFYQGPAHSGGQFMILTETASGPGADAMLKGRGSVPPAGSGLIGGAYRQESIIFSVSIRSTDQGKLQALVAEIKRNLK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.