Scaffold Ga0209971_1004016

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0209971_1004016

Scaffold Ga0209971_1004016

Overview

Basic Information
Taxon OID	3300027682 Open in IMG/M
Scaffold ID	Ga0209971_1004016 Open in IMG/M
Source Dataset Name	Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	3479
Total Scaffold Genes	6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	4 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere → Arabidopsis Thaliana Rhizosphere Microbial Communities From The Joint Genome Institute, Usa, That Affect Carbon Cycling

Source Dataset Sampling Location
Location Name	Joint Genome Institute, California, USA
Coordinates	Lat. (^o)	37.931388	Long. (^o)	-122.021761	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F002806	Metagenome	529	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0209971_10040165	F002806	N/A	MPAPLYLLIAVILLLATLGRIVFRAAPKGVDWALEVAFIRLEFPPPQRVVAQQLAAGLAEIVGMKIKQLKPEHNLTEIAGWAEDGIYARDLITLFLVAFNVRCDELTTFRDLVEKVTRKKTDPIDQAAVVG

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.