NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209392_1008104

Scaffold Ga0209392_1008104


Overview

Basic Information
Taxon OID3300027683 Open in IMG/M
Scaffold IDGa0209392_1008104 Open in IMG/M
Source Dataset NameFreshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015 (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3148
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (16.67%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment → Freshwater Sediment Microbial Communities From Cottonwood Lakes Research Site Near Jamestown, North Dakota, Usa

Source Dataset Sampling Location
Location Namenear Jamestown, North Dakota
CoordinatesLat. (o)47.0956Long. (o)-99.1001Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F022882Metagenome / Metatranscriptome212N
F038230Metagenome166N
F041020Metagenome / Metatranscriptome160Y

Sequences

Protein IDFamilyRBSSequence
Ga0209392_10081044F041020N/AMKLTPKEKAKELFDHYHILITAIGGELGNEILVSILAEQCALFFAMQMQQEKWDQKKYTAYEYWHEVEVEIVNIGMYAM
Ga0209392_10081045F038230GGAMQCKKDRNAYMREYMKRYRATMNEYTYKKIRERENHRLRAKYHAMTDEERQKYIEYQRTYHKLKQFTNE
Ga0209392_10081046F022882N/AMSNLTQYQPRNSDEQAIISARSNRIANMEQKDAYKQTLNVISSVFPMYGIDGDLAFYANIAKEIVKTFGQIAANEIEIAFRLFSAESLELDDDIKFYGKANMHTIGKILNGYMTYRRKIIASHDNEVAALRHQVQMEERGKAEREKLYAEFPTMIKEFTGKTFEDVPL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.