Basic Information | |
---|---|
Taxon OID | 3300027686 Open in IMG/M |
Scaffold ID | Ga0209071_1163463 Open in IMG/M |
Source Dataset Name | Marine microbial communities from the West Antarctic Peninsula - Coastal water metaG108-DNA (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 631 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
Not Available | (Source: ) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From The West Antarctic Peninsula, For Metatranscriptomic Analysis |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Atlantic Ocean: West Antarctic Peninsula | |||||||
Coordinates | Lat. (o) | -64.8156 | Long. (o) | -64.0406 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F013024 | Metagenome / Metatranscriptome | 275 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0209071_11634632 | F013024 | N/A | MEKPATKFIATKLFWLGVIGTYILAGILLNRLETNAGYEELRFTSLIPTLFYFFILFLSYRSFETQAVRTTILQFVTQMLLLLPLMAMYMAV |
⦗Top⦘ |