NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209164_1204642

Scaffold Ga0209164_1204642


Overview

Basic Information
Taxon OID3300027690 Open in IMG/M
Scaffold IDGa0209164_1204642 Open in IMG/M
Source Dataset NameEnrichment culture microbial communities from rom New York Harbor, USA that are MTBE-degrading - MTBE-NYH (New York Harbor Sulfidogenic) MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)658
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Deltaproteobacteria incertae sedis → Candidatus Desulfacyla → Candidatus Desulfacyla euxinica(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Lab Enrichment → Defined Media → Anaerobic Media → Unclassified → Enrichment Culture → Enrichment Culture Microbial Communities From Rutgers University That Are Mtbe-Degrading

Source Dataset Sampling Location
Location NameUSA: New York Harbor
CoordinatesLat. (o)40.67Long. (o)-74.01Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F067248Metagenome126Y

Sequences

Protein IDFamilyRBSSequence
Ga0209164_12046421F067248GGAMVKPLKEKEIVENLKLLADWLRVKYPGEHFELIVAGGAAMTLEGFKGQTTDIDLLSPRVLPDSLRKGIAQVGRAKKLGAEWLNTGLANMLSKAAGSVTLPKYFGEVSRTLEVSDNLSIGLISRQALISLKMYATTPSYRKHTEDLSNLQPNRNEIAEALRFVMSIDDSDPRKDDLRIVMKELGF
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.