Basic Information | |
---|---|
Taxon OID | 3300027691 Open in IMG/M |
Scaffold ID | Ga0209485_1023750 Open in IMG/M |
Source Dataset Name | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS100 (SPAdes) |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1428 |
Total Scaffold Genes | 3 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → FCB group → Gemmatimonadetes → Gemmatimonadetes → Gemmatimonadales → Gemmatimonadaceae → unclassified Gemmatimonadaceae → Gemmatimonadaceae bacterium | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil → Agricultural Soil Microbial Communities From Utah And Georgia To Study Nitrogen Management |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | USA: North Logan, Utah | |||||||
Coordinates | Lat. (o) | 41.7655 | Long. (o) | -111.8143 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F018331 | Metagenome / Metatranscriptome | 235 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0209485_10237502 | F018331 | N/A | MTTRAGLEAEAITRLTEGIEPPEVRAILVQCLAGDLAPSDAISRMLSESGAVSVRLAIDDVTHRAATLSRASDMLVQDRVDELTQIFVEMVAAIAAANGAVKTRSRPEQPLHPSGSAEPGEAQSAE |
⦗Top⦘ |