NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209752_1052913

Scaffold Ga0209752_1052913


Overview

Basic Information
Taxon OID3300027699 Open in IMG/M
Scaffold IDGa0209752_1052913 Open in IMG/M
Source Dataset NameMarine microbial communities from oxygen minimum zone in mesopelagic equatorial Pacific - METZYME_3_250m (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1334
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Oxygen Minimum Zone In The Mesopelagic Equatorial Pacific

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)8.0Long. (o)-156.0Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001334Metagenome / Metatranscriptome720Y
F003285Metagenome / Metatranscriptome496Y

Sequences

Protein IDFamilyRBSSequence
Ga0209752_10529131F003285GAGMPDQESIHNLQTEIQTLKIKDEFRTKELDALMKKLSDTSSKLNALSENIGRLLAGQELHKTSDNEVRDELKILHTRIGDLHDKCTEMIDKTETRVSSDISLLYKKVDSLERWRWITIGIATAIAWLLTNIIPKFLSN
Ga0209752_10529132F001334GGAMMKFKEYLQINADDSIEQVINGEWITKSRTTWKATDNEDNKIEIHNDGHDPELNGESWSVHTNTFAPKAFAFFCKQFITEVRPAELSYARSRIYPQSPN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.