NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209816_1042422

Scaffold Ga0209816_1042422


Overview

Basic Information
Taxon OID3300027704 Open in IMG/M
Scaffold IDGa0209816_1042422 Open in IMG/M
Source Dataset NameMarine microbial communities from the West Antarctic Peninsula - Coastal water metaG017-DNA (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)2128
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → Viruses → unclassified viruses → Circular genetic element sp.(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine → Marine Microbial Communities From The West Antarctic Peninsula, For Metatranscriptomic Analysis

Source Dataset Sampling Location
Location NameAtlantic Ocean: West Antarctic Peninsula
CoordinatesLat. (o)-64.8156Long. (o)-64.0406Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001611Metagenome / Metatranscriptome663N
F024207Metagenome / Metatranscriptome207Y

Sequences

Protein IDFamilyRBSSequence
Ga0209816_10424224F001611AGGAMPLVQKTLTLAAGATSDNILANTNYEFVDGNVRLRISSAVDTAGTTATADTFLNVSVNNAEFSKDVSVPALVTGSPFGVLNGTYVNNDLITTGAMRNRVLVRFTNDTSGTRTIRCGIFIG
Ga0209816_10424225F024207N/ASAIGLGGSLLFGGSDEKMKPILTQSRRNKSKVRQLVNFMGIEGTADFLSQSGGRNVSPNDVVALLLRTFRNDGAFITKAQVRNLRRTTNRFKSLEKQVKEATSMSKTTRRAPVRRSASSTTLIRN
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.