NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209188_1000512

Scaffold Ga0209188_1000512


Overview

Basic Information
Taxon OID3300027708 Open in IMG/M
Scaffold IDGa0209188_1000512 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)37268
Total Scaffold Genes56 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)37 (66.07%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameLake Croche, Canada
CoordinatesLat. (o)46.8319Long. (o)-72.5Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F008619Metagenome330Y
F011148Metagenome / Metatranscriptome294Y
F012668Metagenome / Metatranscriptome278Y

Sequences

Protein IDFamilyRBSSequence
Ga0209188_100051237F011148GGAGMAVFNKNTLTQVSGFDNQIIAGELVWQQKTFWNLALLDNNQVPLDLTGTTIDAQIIRRVLTNVRDSRYGLSFDIGDYTPTPDPIPLTITNISNADGSFTLVIDDDAWDLVAGQPELNISNINGAGFSGRIKISFPEIGTTPANDLIIFLLFIVRSDAIVNN
Ga0209188_100051241F008619AGGAGMAGFQDIVEIQQSMTVNNRRTIGQQVSRSGQLRVAQYLTSVPWVFTITPHEYLYYPQVRNIIQAIDNLDRLSQQAITFQSDNLKWFTAMQGTATSATLASTPPTNSQTLALSSNGTFKAGDFIEVGGYVYKVTEDSAGSVVNIHRPIIGSPTAGATVTMGNAVSFNVVAEQCPTYTLMPMTNGAFVKWDSPFVFRENIAN
Ga0209188_100051249F012668N/AMSIARYENVVINNVTNSVNTYGEQTTTITEWFKTRARVADVANSVRIADKYRVYSDLVNLTFNYTPNQKAIVDNQDLYSITWRGFDWRITDVRESNDRMNVTLLCYRNDPNTPV
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.