NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209188_1008458

Scaffold Ga0209188_1008458


Overview

Basic Information
Taxon OID3300027708 Open in IMG/M
Scaffold IDGa0209188_1008458 Open in IMG/M
Source Dataset NameFreshwater microbial communities from Lake Croche, Canada to study carbon cycling - C_130625_EF_MetaG (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)6054
Total Scaffold Genes16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)12 (75.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)4 (100.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake → Freshwater Microbial Communities From Northern Lakes Of Canada To Study Carbon Cycling

Source Dataset Sampling Location
Location NameLake Croche, Canada
CoordinatesLat. (o)46.8319Long. (o)-72.5Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002977Metagenome / Metatranscriptome516Y
F003080Metagenome / Metatranscriptome508Y
F009462Metagenome / Metatranscriptome317Y
F024559Metagenome / Metatranscriptome205Y

Sequences

Protein IDFamilyRBSSequence
Ga0209188_100845812F024559GGAMTSALIKLVLGIILIFIAVALGPLVGIWSLNTLFPVLHIPYTLETWAAFFLLFGSVSGLRFGSKKL
Ga0209188_100845813F009462AGGAGMELHESVRNSYKEMTIKEQEGFRLVLKKHEVLSPKGLVSVNLEQQNLKDGEVVDSSTYNYFMTKEELQALATGLTS
Ga0209188_10084584F002977AGGAGMTSELPAEGILKHNSWGDSKVYRVTCSCGASDHDHHVWVEADDHEVSVTIYSTTRTNFWSKTRWYHIWTLLTKGYIDTETSLIMNKQVALNYASVLQSAIEDVEQFRKKNE
Ga0209188_10084585F003080AGGAGMTTAKELTENLINRAKNLQEFVVRREFDDIPFNGVVKFNVQHTMGELARIFVPALTQEEAEEMVDEWFEEMDDDF
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.