NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209228_1167762

Scaffold Ga0209228_1167762


Overview

Basic Information
Taxon OID3300027709 Open in IMG/M
Scaffold IDGa0209228_1167762 Open in IMG/M
Source Dataset NameMarine microbial communities from oxygen minimum zone in mesopelagic equatorial Pacific - METZYME_3_150m (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)639
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine → Marine Microbial Communities From Oxygen Minimum Zone In The Mesopelagic Equatorial Pacific

Source Dataset Sampling Location
Location NamePacific Ocean
CoordinatesLat. (o)8.0Long. (o)-156.0Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002874Metagenome / Metatranscriptome524Y
F007052Metagenome / Metatranscriptome359Y
F068113Metagenome125Y

Sequences

Protein IDFamilyRBSSequence
Ga0209228_11677621F007052N/AGKFLSSEIFESLEEARVWGMKESKRLISHLEMLRMTNVGDICVKIDKHFFVYESSLEELMKNSVKVI
Ga0209228_11677622F002874N/AMSKNSTKVDLSLNRSLQELEDSYWEFIDVTEGDDSANWPKSVQEDFSALEGYLMKQDRL
Ga0209228_11677623F068113AGGAMRNEIEKVLEAMREDYKRWSNRCARHDSYEGYSDVKKEMEKDYCEGLEVTEGSRYWKIISDKRGSRSVCGFIAKAGDKKFREGDMLK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.