NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209599_10001718

Scaffold Ga0209599_10001718


Overview

Basic Information
Taxon OID3300027710 Open in IMG/M
Scaffold IDGa0209599_10001718 Open in IMG/M
Source Dataset NameSubsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)9889
Total Scaffold Genes23 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)17 (73.91%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa

Source Dataset Sampling Location
Location NameOhio, USA
CoordinatesLat. (o)39.849Long. (o)-81.036Alt. (m)Depth (m)2500
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000166Metagenome / Metatranscriptome1810Y
F014143Metagenome / Metatranscriptome265Y
F042804Metagenome / Metatranscriptome157Y

Sequences

Protein IDFamilyRBSSequence
Ga0209599_1000171813F000166N/AMANIPNQQDAELFAQSVKKWQEVLNLGDWRIEKGIKPAKAAMASVEFNASARLATYRLGDFGAEKITPESLDKTALHELLHIFLHDLMCVAQDPKSSQEEIEMQEHRVINLLENLISKDSHGIK
Ga0209599_1000171818F042804GAGMRHMELSRWITTNGDSCSSEQLLVLWNNLAGWSGVADSAEMRAKVLYYYARAREREKK
Ga0209599_100017186F014143GGTGGMNTRFLTHVRKIFATYDAPPEVIRGYQKQWVKSVRQLGDKWLVAKPIGRIQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.