NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0209599_10002377

Scaffold Ga0209599_10002377


Overview

Basic Information
Taxon OID3300027710 Open in IMG/M
Scaffold IDGa0209599_10002377 Open in IMG/M
Source Dataset NameSubsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)7815
Total Scaffold Genes21 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)19 (90.48%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa

Source Dataset Sampling Location
Location NameOhio, USA
CoordinatesLat. (o)39.849Long. (o)-81.036Alt. (m)Depth (m)2500
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000808Metagenome / Metatranscriptome882Y
F063685Metagenome / Metatranscriptome129Y
F093770Metagenome / Metatranscriptome106Y

Sequences

Protein IDFamilyRBSSequence
Ga0209599_1000237712F093770AGGMITLNHSINLVTEIDEHKMPSDLLSSFLNLSEIQMEYLLRSAFISALENEGFLETINENNSWAIVKVGQN
Ga0209599_1000237715F000808GGAMEYLYSLTTSYDGSLVNTLRSADLLEIVDAWNKCVDHGNAKEHATYNLSDPSGKMFTKIFFSDGEVSVK
Ga0209599_100023777F063685GGAGMSEGFFTIELGRYGFMFDTNWSYVAISWELIIISALVFAGYKFYKRKKITK
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.