Scaffold Ga0209599_10014582

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0209599_10014582

Scaffold Ga0209599_10014582

Overview

Basic Information
Taxon OID	3300027710 Open in IMG/M
Scaffold ID	Ga0209599_10014582 Open in IMG/M
Source Dataset Name	Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FT (SPAdes)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	2308
Total Scaffold Genes	5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (20.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea → unclassified Archaea → archaeon	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface → Subsurface Microbial Communities From Deep Shales In Ohio And West Virginia, Usa

Source Dataset Sampling Location
Location Name	Ohio, USA
Coordinates	Lat. (^o)	39.849	Long. (^o)	-81.036	Alt. (m)		Depth (m)	2500
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F056617	Metagenome / Metatranscriptome	137	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0209599_100145824	F056617	N/A	MKHRAKYEKLLKNSKGQYRYQFNWVSGGFNNIWAKNLKEFKVELKRQFGNSNLDVDYSTLHKATESGARSWDRAGNMLCW

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.